NONO Antibody / p54nrb | RQ4624

NONO Antibody / p54nrb | RQ4624 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Purified

Clone: 11E2-

Host Animal: Mouse

Clonality: Monoclonal (mouse origin)

Species Reactivity: Human

Application: WB, ICC, FACS

Buffer: N/A

Limitation: This NONO antibody is available for research use only.

Purity: Protein G affinity

Description: Non-POU domain-containing octamer-binding protein is a protein that in humans is encoded by the NONO gene. This gene encodes an RNA-binding protein which plays various roles in the nucleus, including transcriptional regulation and RNA splicing. A rearrangement between this gene and the transcription factor E3 gene has been observed in papillary renal cell carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes exist on Chromosomes 2 and 16.

Immunogen: Amino acids MQSNKTFNLEKQNHTPRKHHQHHHQQQHHQQQQQQ were used as the immunogen for the NONO antibody.

Storage: After reconstitution, the NONO antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.