NFIA Antibody | RQ4923

NFIA Antibody | RQ4923 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Purified

Clone: 16H11

Host Animal: Mouse

Clonality: Monoclonal (mouse origin)

Species Reactivity: Human

Application: WB, IHC-P, FACS, IF

Buffer: Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Limitation: This NFIA antibody is available for research use only.

Purity: Purified

Description: Nuclear factor 1 A-type is a protein that in humans is encoded by the NFIA gene. Nuclear factor I (NFI) proteins constitute a family of dimeric DNA-binding proteins with similar, and possibly identical, DNA-binding specificity. They function as cellular transcription factors and as replication factors for adenovirus DNA replication. Diversity in this protein family is generated by multiplegenes, differential splicing, and heterodimerization.

Immunogen: Amino acids AYFVHAADSSQSESPSQPSDADIKDQPENGHLGFQDSFVTSGVFS from the human protein were used as the immunogen for the NFIA antibody.

Storage: After reconstitution, the NFIA antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.