Description
NFIA Antibody | RQ4923 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Purified
Clone: 16H11
Host Animal: Mouse
Clonality: Monoclonal (mouse origin)
Species Reactivity: Human
Application: WB, IHC-P, FACS, IF
Buffer: Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Limitation: This NFIA antibody is available for research use only.
Purity: Purified
Description: Nuclear factor 1 A-type is a protein that in humans is encoded by the NFIA gene. Nuclear factor I (NFI) proteins constitute a family of dimeric DNA-binding proteins with similar, and possibly identical, DNA-binding specificity. They function as cellular transcription factors and as replication factors for adenovirus DNA replication. Diversity in this protein family is generated by multiplegenes, differential splicing, and heterodimerization.
Immunogen: Amino acids AYFVHAADSSQSESPSQPSDADIKDQPENGHLGFQDSFVTSGVFS from the human protein were used as the immunogen for the NFIA antibody.
Storage: After reconstitution, the NFIA antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.
