NDRG2 Antibody | R32351

(No reviews yet) Write a Review
SKU:
800-R32351
Weight:
1.20 KGS
€986.00
Frequently bought together:

Description

NDRG2 Antibody | R32351 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human, Mouse, Rat

Application: WB, IHC-P

Buffer: N/A

Limitation: This NDRG2 antibody is available for research use only.

Purity: Antigen affinity

Description: NDRG2 contributes to the regulation of the Wnt signaling pathway. Down-regulates CTNNB1-mediated transcriptional activation of target genes, such as CCND1, and may thereby act as tumor suppressor. May be involved in dendritic cell and neuron differentiation. [UniProt]

Immunogen: Amino acids NSELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFER of human NDRG2 were used as the immunogen for the NDRG2 antibody.

Storage: After reconstitution, the NDRG2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

View AllClose

Additional Information

Size:
100 ug
View AllClose