Description
MVD Antibody / Mevalonate pyrophosphate decarboxylase | RQ4089 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Antigen affinity purified
Clone: N/A
Host Animal: Rabbit
Clonality: Polyclonal (rabbit origin)
Species Reactivity: Human
Application: WB
Buffer: Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Limitation: This MVD antibody is available for research use only.
Purity: Antigen affinity purified
Description: The enzyme mevalonate pyrophosphate decarboxylase (MVD; EC 4.1.1.33) catalyzes the conversion of mevalonate pyrophosphate into isopentenyl pyrophosphate. This unusual enzyme decarboxylates and dehydrates its substrate while hydrolyzing ATP. As a unique enzyme in one of the early steps in cholesterol biosynthesis, MVD may be a useful target for drugs aimed at lowering serum cholesterol levels. This gene is mapped to chromosome 16q24.3 based on an alignment of the MVDsequence.
Immunogen: Amino acids KDFTEDRIWLNGREEDVGQPRLQACLREIRCLARKRR from the human protein were used as the immunogen for the MVD antibody.
Storage: After reconstitution, the MVD antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.
