MUNC18-1 Antibody / STXBP1 | R32158

MUNC18-1 Antibody / STXBP1 | R32158 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human, Mouse, Rat

Application: WB, IHC-P, IF, FACS

Buffer: N/A

Limitation: This MUNC18-1 antibody is available for research use only.

Purity: Antigen affinity

Description: Syntaxin-binding protein 1, also known as Munc18-1, is a protein that in humans is encoded by the STXBP1 gene. By fluorescence in situ hybridization, the STXBP1 gene is mapped to chromosome 9q34.1. This gene encodes a syntaxin-binding protein. The encoded protein appears to play a role in release of neurotransmitters via regulation of syntaxin, a transmembrane attachment protein receptor. Mutations in this gene have been associated with infantile epileptic encephalopathy-4. Alternatively spliced transcript variants have been described.

Immunogen: Amino acids KEYPAVRYRGEYKDNALLAQLIQDKLDAYKADD of human MUNC18-1 were used as the immunogen for the MUNC18-1 antibody.

Storage: After reconstitution, the MUNC18-1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.