Description
MUC2 Antibody / Mucin 2 | RQ4080 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Antigen affinity purified
Clone: N/A
Host Animal: Rabbit
Clonality: Polyclonal (rabbit origin)
Species Reactivity: Human, Mouse, Rat
Application: IHC-P, IF
Buffer: Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Limitation: This Mucin 2 antibody is available for research use only.
Purity: Antigen affinity purified
Description: Mucin 2, also known as MUC2, is a protein that in humans is encoded by the MUC2 gene. This gene encodes a member of the mucin protein family. It is mapped to 11p15.5. Mucin 2 is particularly prominent in the gut where it is secreted from goblet cells in the epithelial lining into the lumen of the large intestine. There, mucin 2, along with small amounts of related-mucin proteins, polymerizes into a gel of which 80% by weight is oligosaccharide side-chains that are added as post-translational modifications to the mucin proteins. This gel provides an insoluble mucous barrier that serves to protect the intestinal epithelium. The primary function of the MUC2 gene product is to provide a protective barrier between the epithelial surfaces and the gut lumen. There is decreased expression of MUC2 in colonic cancer and defective polymerization of secreted mucin in ulcerative colitis.
Immunogen: Amino acids DDFKTASGLVEATGAGFANTWKAQSTCHDKLDWLDD from the human protein were used as the immunogen for the Mucin 2 antibody.
Storage: After reconstitution, the Mucin 2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.