Description
Monoamine Oxidase A Antibody / MAOA | R32008 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Antigen affinity purified
Clone: N/A
Host Animal: Rabbit
Clonality: Polyclonal (rabbit origin)
Species Reactivity: Human, Mouse, Rat
Application: WB, IHC-P, IF, FACS
Buffer: N/A
Limitation: This MAOA antibody is available for research use only.
Purity: Antigen affinity
Description: Monoamine oxidase A is an enzyme that in humans is encoded by the MAO-A gene. MAOA is an isozyme of monoamine oxidase which is also mapped on Xp11.3. MAOA degrades amine neurotransmitters, such as dopamine, norepinephrine, and serotonin. The protein localizes to the outer mitochondrial membrane. Mutation in MAOA results in monoamine oxidase deficiency, or Brunner syndrome. In humans, there is a 30-base repeat sequence repeated in one of several different numbers of times in the promoter region of the gene coding for MAOA. MAO-A levels in the brain as measured using positron emission tomography are elevated by an average of 34% in patients with major depressive disorder. Inhibition of MAOA prevented apoptosis, and serum starvation of cortical brain cells from Maoa-deficient mice resulted in reduced apoptosis compared with wildtype mice.
Immunogen: Amino acids REVLNGLGKVTEKDIWVQEPESKDVPAVEITHTFWER of human MAOA were used as the immunogen for the MAOA antibody.
Storage: After reconstitution, the MAOA antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.
