Description
METTL3 Antibody / M6A | RQ6198 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Antigen affinity purified
Clone: N/A
Host Animal: Rabbit
Clonality: Polyclonal (rabbit origin)
Species Reactivity: Human
Application: WB, FACS, IHC-P, IF, Direct ELISA
Buffer: N/A
Limitation: This METTL3 antibody is available for research use only.
Purity: Affinity purified
Description: N6-adenosine-methyltransferase 70 kDa subunit (METTL3) is an enzyme that in humans is encoded by the METTL3 gene. It is mapped to 14q11.2. This gene encodes the 70 kDa subunit of MT-A which is part of N6-adenosine-methyltransferase. This enzyme is involved in the posttranscriptional methylation of internal adenosine residues in eukaryotic mRNAs, forming N6-methyladenosine.
Immunogen: Amino acids HNVQPNWITLGNQLDGIHLLDPDVVARFKQRYPDGIISKPKNL from the human protein were used as the immunogen for the METTL3 antibody.
Storage: After reconstitution, the METTL3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.