MDM4 Antibody / MDMX | R31805

(No reviews yet) Write a Review
SKU:
800-R31805
Weight:
1.20 KGS
€986.00
Frequently bought together:

Description

MDM4 Antibody / MDMX | R31805 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human, Mouse

Application: WB, IHC-P

Buffer: N/A

Limitation: This MDM4 antibody is available for research use only.

Purity: Antigen affinity

Description: Protein Mdm4 is a protein that in humans is encoded by the MDM4 gene. This gene encodes a nuclear protein that contains a p53 binding domain at the N-terminus and a RING finger domain at the C-terminus, and shows structural similarity to p53-binding protein MDM2. Both proteins bind the p53 tumor suppressor protein and inhibit its activity, and have been shown to be overexpressed in a variety of human cancers. However, unlike MDM2 which degrades p53, this protein inhibits p53 by binding its transcriptional activation domain. This protein also interacts with MDM2 protein via the RING finger domain, and inhibits the latter's degradation. So this protein can reverse MDM2-targeted degradation of p53, while maintaining suppression of p53 transactivation and apoptotic functions. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.

Immunogen: Amino acids KILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQH of human MDM4 were used as the immunogen for the MDM4 antibody.

Storage: After reconstitution, the MDM4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

View AllClose

Additional Information

Size:
100 ug
View AllClose