MCUR1 Antibody / Mitochondrial calcium uniporter regulator 1 | RQ4944

MCUR1 Antibody / Mitochondrial calcium uniporter regulator 1 | RQ4944 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human, Mouse, Rat

Application: WB, IHC-P

Buffer: Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Limitation: This MCUR1 antibody is available for research use only.

Purity: Antigen affinity purified

Description: MCUR1 is an inner mitochondrial membrane protein that has been shown to function as a component of the mitochondrial Ca(2+) uniporter, in the assembly of mitochondrial respiratory complex IV, and in mitochondrial permeability transition (MPT). The MCUR1 gene is mapped to chromosome 6p23 based on an alignment of the MCUR1 sequence with the genomic sequence.

Immunogen: Amino acids ATQQAEIIVSALVKILEANMDIVYKDMVTKMQQE from the human protein were used as the immunogen for the MCUR1 antibody.

Storage: After reconstitution, the MCUR1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.