Description
MCM8 Antibody | R32347 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Antigen affinity purified
Clone: N/A
Host Animal: Rabbit
Clonality: Polyclonal (rabbit origin)
Species Reactivity: Human
Application: WB
Buffer: N/A
Limitation: This MCM8 antibody is available for research use only.
Purity: Antigen affinity
Description: DNA replication licensing factor MCM8 is a protein that in humans is encoded by the MCM8 gene. The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein contains the central domain that is conserved among the MCM proteins. And this protein has been shown to co-immunoprecipitate with MCM4, 6 and 7, which suggests that it may interact with other MCM proteins and play a role in DNA replication. Alternatively spliced transcript variants encoding distinct isoforms have been described.
Immunogen: Amino acids IQVADFENFIGSLNDQGYLLKKGPKVYQLQTM of human MCM8 were used as the immunogen for the MCM8 antibody.
Storage: After reconstitution, the MCM8 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.