MC2 Receptor Antibody / ACTH Receptor | R32754

MC2 Receptor Antibody / ACTH Receptor | R32754 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Mouse, Rat

Application: WB

Buffer: Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide

Limitation: This MC2R antibody is available for research use only.

Purity: Antigen affinity

Description: Melanocortin-2 receptor (MC2R), also known as ACTH receptor (ACTHR), is a member of the G protein-coupled receptor family. This gene is mapped to 18p11.2. MC2R is selectively activated by adrenocorticotropic hormone, whereas the other four melanocortin receptors recognize a variety of melanocortin ligands. Mutations in MC2R can result in familial glucocorticoid deficiency. Alternate transcript variants have been found for this gene.

Immunogen: Amino acids 268-297 (NAVIDPFIYAFRSPELRDAFKKMIFCSRYW) from the human protein were used as the immunogen for the MC2R antibody.

Storage: After reconstitution, the MC2R antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.