Description
MADCAM1 Antibody | RQ4529 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Purified
Clone: N/A
Host Animal: Rabbit
Clonality: Polyclonal (rabbit origin)
Species Reactivity: Human
Application: WB
Buffer: N/A
Limitation: This MADCAM1 antibody is available for research use only.
Purity: Antigen affinity
Description: Mucosal Vascular Addressin Cell Adhesion Molecule 1 is a protein that in humans is encoded by the MADCAM1 gene. By PCR-based analysis of somatic cell hybrids, Leung et al.(1997) mapped the gene to chromosome 19. The protein encoded by this gene is an endothelil cell adhesion molecule that interacts preferentially with the leukocyte beta7 integrin LPAM-1(alpha4 / beta7), L-selectin, and VLA-4(alpha4/beta1) on myeloid cells to direct leukocytes into mucosal and inflamed tissues. It is a member of the immunoglobulin superfamily and is similar to ICAM-1 and VCAM-1.
Immunogen: Amino acids QELEGAQALGPEVQEEEEEPQGDEDVLFRVTERWRL were used as the immunogen for this MADCAM1 antibody.
Storage: After reconstitution, the MADCAM1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.
