LOX-1 Antibody / OLR1 (Middle Region) | R32862

LOX-1 Antibody / OLR1 (Middle Region) | R32862 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human

Application: WB

Buffer: Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide

Limitation: This LOX-1 antibody is available for research use only.

Purity: Antigen affinity

Description: OLR1 (oxidized low density lipoprotein (lectin-like) receptor 1) also called CLEC8A, LOX-1, SCARE1, is a receptor protein which belongs to the C-type lectin superfamily. The OLR1 gene encodes a cell-surface endocytosis receptor for oxidized low density lipoprotein (OxLDL). This gene is mapped on 12p13.2. Incubation of the cells with LDL had no effect on LOX1 expression, but incubation with OxLDL resulted in a dose-dependent increase in LOX1 mRNA and protein expression; however, very high concentrations of OxLDL caused a decrease in OxLDL expression, perhaps indicating toxic effects on endothelial cells. LOX1 was also expressed in macrophages, but not in vascular smooth muscle cells. The findings suggested a role for LOX1 in the pathophysiology of atherosclerotic cardiovascular disease. LOX1 expression was detected in all choroidal neovascular membranes, regardless of structure, whereas there was no evidence of LOX1 within the posterior segments of normal eyes. LOX1 plays an active role in the pathogenesis of choroidal neovascularization, especially in ARMD.

Immunogen: Amino acids 162-197 (SFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISY) were used as the immunogen for the LOX-1 antibody.

Storage: After reconstitution, the LOX-1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.