Kv1.4 Antibody | R32018

(No reviews yet) Write a Review
SKU:
800-R32018
Weight:
1.20 KGS
€986.00
Frequently bought together:

Description

Kv1.4 Antibody | R32018 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human

Application: WB, IHC-P

Buffer: N/A

Limitation: This Kv1.4 antibody is available for research use only.

Purity: Antigen affinity

Description: Potassium voltage-gated channel subfamily A member 4, also known as Kv1.4 or PCN2, mediates transmembrane potassium transport in excitable membranes. Forms tetrameric potassium-selective channels through which potassium ions pass in accordance with their electrochemical gradient. [UniProt]

Immunogen: Amino acids SEYLEMEEGVKESLCAKEEKCQGKGDDSETDKNNCSNAK of human Kv1.4 were used as the immunogen for the Kv1.4 antibody.

Storage: After reconstitution, the Kv1.4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

View AllClose

Additional Information

Size:
100 ug
View AllClose