Description
KIM-1 Antibody / TIM-1 / HAVCR1 | R32305 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Antigen affinity purified
Clone: N/A
Host Animal: Rabbit
Clonality: Polyclonal (rabbit origin)
Species Reactivity: Human
Application: WB
Buffer: N/A
Limitation: This KIM1 antibody is available for research use only.
Purity: Antigen affinity
Description: Kidney injury molecule 1, also known as HAVCR1, HAVCR or TIM1, is a protein that in humans is encoded by the HAVCR1 gene. It may play a role in T-helper cell development and the regulation of asthma and allergic diseases. Receptor for TIMD4 (By similarity). May play a role in kidney injury and repair. [UniProt]
Immunogen: Amino acids QQLSVSFSSLQIKALQNAVEKEVQAEDNIYIENSLYATD of human HAVCR1 were used as the immunogen for the KIM1 antibody.
Storage: After reconstitution, the KIM1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.
