Description
ITLN1 Antibody / Intelectin-1 | R32441 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Antigen affinity purified
Clone: N/A
Host Animal: Rabbit
Clonality: Polyclonal (rabbit origin)
Species Reactivity: Human
Application: WB, IHC-P, IF, FACS
Buffer: Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
Limitation: This ITLN1 antibody is available for research use only.
Purity: Antigen affinity
Description: Intelectin-1, also known as omentin, is an intelectin encoded in humans by the ITLN1 gene. This gene is mapped to chromosome 1q21.3-q22 by genomic sequence analysis. It is expressed on multiple cell types and appears to participate in insulin signaling and microbe recognition. Intelectin-1 functions both as a receptor for bacterial arabinogalactans and for lactoferrin. Having conserved ligand binding site residues, both human and mouse intelectin-1 bind the exocyclic vicinal diol of carbohydrate ligands such as galactofuranose.
Immunogen: Amino acids TDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLR were used as the immunogen for the ITLN1 antibody.
Storage: Prior to reconstitution, store at 4oC. After reconstitution, the ITLN1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.