IL-18R Beta Antibody | RQ6190

(No reviews yet) Write a Review
SKU:
800-RQ6190
Weight:
1.20 KGS
€986.00
Frequently bought together:

Description

IL-18R Beta Antibody | RQ6190 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human

Application: WB

Buffer: N/A

Limitation: This IL-18R Beta antibody is available for research use only.

Purity: Affinity purified

Description: Interleukin 18 receptor accessory protein, also known as IL18RAP and CDw218b (cluster of differentiation w218b), is a human gene. The protein encoded by this gene is an accessory subunit of the heterodimeric receptor for interleukin 18 (IL18), a proinflammatory cytokine involved in inducing cell-mediated immunity. This protein enhances the IL18-binding activity of the IL18 receptor and plays a role in signaling by IL18. Mutations in this gene are associated with Crohn's disease and inflammatory bowel disease, and susceptibility to celiac disease and leprosy. Alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known.

Immunogen: Amino acids SIFELQAAVNLALDDQTLKLILIKFCYFQEPESLPHLVKKALR from the human protein were used as the immunogen for the IL-18R Beta antibody.

Storage: After reconstitution, the IL-18R Beta antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

View AllClose

Additional Information

Size:
100 ug
View AllClose