Description
IGFBP5 Antibody | R32028 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Antigen affinity purified
Clone: N/A
Host Animal: Rabbit
Clonality: Polyclonal (rabbit origin)
Species Reactivity: Human
Application: WB, ELISA
Buffer: N/A
Limitation: This IGFBP5 antibody is available for research use only.
Purity: Antigen affinity
Description: Insulin-like growth factor-binding protein 5 is a protein that in humans is encoded by the IGFBP5 gene. The expression of IGFBP5 by stable transfection and adenovirus-mediated infection is inhibitory to growth in two human breast cancer cell lines. IGFBP5 expression leads to G2/M cell cycle arrest and apoptosis. Stable expression of IGFBP5 in the breast cancer cell lines also inhibits the formation and growth of tumors following injection in athymic mice. It is concluded that IGFBP5 is a growth inhibitor and proapoptotic agent in breast cancer cells. Additionally, IGFBP-5 is expressed by fibroblasts, myoblasts and osteoblasts, making it the predominant IGFBP found in bone extracts. It has a strong affinity for hydroxyapatite, allowing it to bind to bone cells. When bound to extracellular matrix, IGFBP-5 is protected from proteolysis and potentiates IGF activity, but when it is soluble, IGFBP-5 is cleaved into inactive fragments.
Immunogen: Amino acids QGLRCLPRQDEEKPLHALLHGRGVCLNEKSYREQVKIER of human IGFBP5 were used as the immunogen for the IGFBP5 antibody.
Storage: After reconstitution, the IGFBP5 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.