IFNAR1 Antibody / Interferon alpha receptor 1 | R32689

IFNAR1 Antibody / Interferon alpha receptor 1 | R32689 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human, Mouse

Application: WB

Buffer: Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide

Limitation: This IFNAR1 antibody is available for research use only.

Purity: Antigen affinity

Description: Interferon-alpha/beta receptor alpha chain is a protein that in humans is encoded by the IFNAR1 gene. The protein encoded by this gene is a type I membrane protein that forms one of the two chains of a receptor for interferons alpha and beta. Binding and activation of the receptor stimulates Janus protein kinases, which in turn phosphorylate several proteins, including STAT1 and STAT2. The encoded protein also functions as an antiviral factor.

Immunogen: Amino acids 263-306 (HAFLKRNPGNHLYKWKQIPDCENVKTTQCVFPQNVFQKGIYLLR) from the human protein were used as the immunogen for the IFNAR1 antibody.

Storage: After reconstitution, the IFNAR1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.