Description
IBA1 Antibody / AIF-1 | R32736 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Antigen affinity purified
Clone: N/A
Host Animal: Rabbit
Clonality: Polyclonal (rabbit origin)
Species Reactivity: Human
Application: WB, IHC-P
Buffer: Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
Limitation: This IBA1 antibody is available for research use only.
Purity: Antigen affinity
Description: Allograft inflammatory factor 1 (AIF-1), also known as ionized calcium-binding adapter molecule 1 (IBA1), is a protein that in humans is encoded by the AIF1 gene. This gene encodes a protein that binds actin and calcium. And this gene is induced by cytokines and interferon and may promote macrophage activation and growth of vascular smooth muscle cells and T-lymphocytes. Polymorphisms in this gene may be associated with systemic sclerosis. Alternative splicing results in multiple transcript variants, but the full-length and coding nature of some of these variants is not certain.
Immunogen: Amino acids 99-133 (ETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEK) from the human protein were used as the immunogen for the IBA1 antibody.
Storage: After reconstitution, the IBA1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.
