HtrA3 Antibody | R32751

HtrA3 Antibody | R32751 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human

Application: WB

Buffer: Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide

Limitation: This HtrA3 antibody is available for research use only.

Purity: Antigen affinity

Description: Human HtrA3 protease, which induces mitochondria-mediated apoptosis, can be a tumor suppressor and a potential therapeutic target in the treatment of cancer. It may also have a role in ovarian development, granulosa cell differentiation and luteinization. The long isoform, HTRA3L, contains 453 amino acids and has a predicted molecular mass of 49 kD. It contains an N-terminal signal peptide, followed by an insulin/IGF (see 147440)-binding domain, a Kazal-type S protease inhibitor domain, a trypsin protease domain, and a PDZ domain. The short isoform, HTRA3S, contains 357 amino acids and has a predicted molecular mass of 38 kD.

Immunogen: Amino acids 330-362 (FAIPSDRITRFLTEFQDKQIKDWKKRFIGIRMR) from the human protein were used as the immunogen for the HtrA3 antibody.

Storage: After reconstitution, the HtrA3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.