Description
HSP90 alpha Antibody / HSP90AA1 | RQ6535 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Antigen affinity purified
Clone: 6B5
Host Animal: Mouse
Clonality: Monoclonal (mouse origin)
Species Reactivity: Human, Mouse, Rat, Monkey
Application: WB, IHC-P, IF, FACS
Buffer: Lyophilized from 1X PBS with 2% Trehalose
Limitation: This HSP90AA1 antibody is available for research use only.
Purity: Affinity purified
Description: Heat shock protein HSP 90-alpha is a protein that in humans is encoded by the HSP90AA1 gene. This gene encodes the human stress-inducible 90-kDa heat shock protein alpha (Hsp90A). Complemented by the constitutively expressed paralog Hsp90B which shares over 85% amino acid sequence identity, Hsp90A expression is initiated when a cell experiences proteotoxic stress. Once expressed Hsp90A dimers operate as molecular chaperones that bind and fold other proteins into their functional 3-dimensional structures. This molecular chaperoning ability of Hsp90A is driven by a cycle of structural rearrangements fueled by ATP hydrolysis. Current research on Hsp90A focuses in its role as a drug target due to its interaction with a large number of tumor promoting proteins and its role in cellular stress adaptation.
Immunogen: Amino acids 454-488 (QNRKKLSELLRYYTSASGDEMVSLKDYCTRMKENQ) from the human protein were used as the immunogen for the HSP90AA1 antibody.
Storage: After reconstitution, the HSP90AA1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.
