HOXB1 Antibody (C-Terminal Region) | R32961

HOXB1 Antibody (C-Terminal Region) | R32961 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human, Mouse, Rat

Application: WB

Buffer: Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide

Limitation: This HOXB1 antibody is available for research use only.

Purity: Antigen affinity

Description: Homeobox protein Hox-B1 is a protein that in humans is encoded by the HOXB1 gene. This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXB genes located in a cluster on chromosome 17.

Immunogen: Amino acids 176-220 (TARTFDWMKVKRNPPKTAKVSEPGLGSPSGLRTNFTTRQLTELEK) were used as the immunogen for the HOXB1 antibody.

Storage: After reconstitution, the HOXB1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.