HMGB3 Antibody / HMG4 | R31810

(No reviews yet) Write a Review
SKU:
800-R31810
Weight:
1.20 KGS
€986.00
Frequently bought together:

Description

HMGB3 Antibody / HMG4 | R31810 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human, Mouse, Rat

Application: WB, IHC-P

Buffer: N/A

Limitation: This HMG4 antibody is available for research use only.

Purity: Antigen affinity

Description: High-mobility group protein B, also known as HMG4, is a protein that in humans is encoded by the HMGB3 gene. This gene encodes a member of a family of proteins containing one or more high mobility group DNA-binding motifs. The encoded protein plays an important role in maintaining stem cell populations, and may be aberrantly expressed in tumor cells. A mutation in this gene was associated with microphthalmia, syndromic 13. There are numerous pseudogenes of this gene on multiple chromosomes. Alternative splicing results in multiple transcript variants.

Immunogen: Amino acids EMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKR of human HMG4 were used as the immunogen for the HMG4 antibody.

Storage: After reconstitution, the HMG4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

View AllClose

Additional Information

Size:
100 ug
View AllClose