Hepatitis B Virus Antibody (Large S Protein) | R32633

(No reviews yet) Write a Review
SKU:
800-R32633
Weight:
1.20 KGS
€986.00
Frequently bought together:

Description

Hepatitis B Virus Antibody (Large S Protein) | R32633 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Hepatitis B Virus (Human)

Application: WB, IHC-P

Buffer: Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide

Limitation: This Hepatitis B Virus antibody is available for research use only.

Purity: Antigen affinity

Description: Hepatitis B virus, abbreviated HBV, is a species of the genus Orthohepadnavirus, which is likewise a part of the Hepadnaviridae family of viruses. This virus causes the disease hepatitis B. It consists of HBsAg, HBcAg (HBeAg is a splice variant), Hepatitis B virus DNA polymerase and HBx. Among these, HBsAg (also known as the Australia antigen) is the surface antigen of the hepatitis B virus (HBV). It indicates current hepatitis B infection. The viral envelope of an enveloped virus has different surface proteins from the rest of the virus which act as antigens. These antigens are recognized by antibody proteins that bind specifically to one of these surface proteins.

Immunogen: Amino acids 4-51 (WSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQ) from the human HBV Large S protein were used as the immunogen for the Hepatitis B Virus antibody.

Storage: After reconstitution, the Hepatitis B Virus antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

View AllClose

Additional Information

Size:
100 ug
View AllClose