Description
Hepatitis B Virus Antibody (Large S Protein) | R32633 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Antigen affinity purified
Clone: N/A
Host Animal: Rabbit
Clonality: Polyclonal (rabbit origin)
Species Reactivity: Hepatitis B Virus (Human)
Application: WB, IHC-P
Buffer: Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
Limitation: This Hepatitis B Virus antibody is available for research use only.
Purity: Antigen affinity
Description: Hepatitis B virus, abbreviated HBV, is a species of the genus Orthohepadnavirus, which is likewise a part of the Hepadnaviridae family of viruses. This virus causes the disease hepatitis B. It consists of HBsAg, HBcAg (HBeAg is a splice variant), Hepatitis B virus DNA polymerase and HBx. Among these, HBsAg (also known as the Australia antigen) is the surface antigen of the hepatitis B virus (HBV). It indicates current hepatitis B infection. The viral envelope of an enveloped virus has different surface proteins from the rest of the virus which act as antigens. These antigens are recognized by antibody proteins that bind specifically to one of these surface proteins.
Immunogen: Amino acids 4-51 (WSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQ) from the human HBV Large S protein were used as the immunogen for the Hepatitis B Virus antibody.
Storage: After reconstitution, the Hepatitis B Virus antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.
