HECTD3 Antibody | RQ4929

(No reviews yet) Write a Review
SKU:
800-RQ4929
Weight:
1.20 KGS
€986.00
Frequently bought together:

Description

HECTD3 Antibody | RQ4929 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human, Mouse, Rat

Application: WB, IHC-P, FACS

Buffer: Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Limitation: This HECTD3 antibody is available for research use only.

Purity: Antigen affinity purified

Description: The protein encoded by this gene transfers ubiquitin from an E2 ubiquitin-conjugating enzyme to targeted substrates, leading to the degradation of those substrates. This gene is mapped to 1p34.1. The encoded protein has been shown to transfer ubiquitin to TRIOBP to facilitate cell cycle progression, and to STX8.

Immunogen: Amino acids HYASAKVCEEKLRYAAYNCVAIDTDMSPWEE from the human protein were used as the immunogen for the HECTD3 antibody.

Storage: After reconstitution, the HECTD3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

View AllClose

Additional Information

Size:
100 ug
View AllClose