Description
HCN2 Antibody | R32802 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Antigen affinity purified
Clone: N/A
Host Animal: Rabbit
Clonality: Polyclonal (rabbit origin)
Species Reactivity: Mouse, Rat
Application: WB, IHC-P
Buffer: Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
Limitation: This HCN2 antibody is available for research use only.
Purity: Antigen affinity
Description: Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated ion channel 2 is a protein that in humans is encoded by the HCN2 gene. The HCN2 gene is localized on human chromosome 19p13.3 and contains eight exons spanning approximately 27 kb. Hyperpolarization-activated cation channels of the HCN gene family, such as HCN2, contribute to spontaneous rhythmic activity in both heart and brain.
Immunogen: Amino acids 682-714 (VFNNQENAIIQEIVKYDREMVQQAELGQRVGLF) from the human protein were used as the immunogen for the HCN2 antibody.
Storage: After reconstitution, the HCN2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.