Description
HAS1 Antibody / Hyaluronan synthase 1 | RQ4648 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Antigen affinity purified
Clone: N/A
Host Animal: Rabbit
Clonality: Polyclonal (rabbit origin)
Species Reactivity: Human, Mouse, Rat
Application: WB, IHC-P, IF/ICC, FACS
Buffer: Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Limitation: This HAS1 antibody is available for research use only.
Purity: Antigen affinity purified
Description: Hyaluronan synthase 1 is an enzyme that in humans is encoded by the HAS1 gene. This gene is mapped to 19q13.41. Hyaluronan or hyaluronic acid (HA) is a high molecular weight unbranched polysaccharide synthesized by a wide variety of organisms from bacteria to mammals, and is a constituent of the extracellular matrix. It consists of alternating glucuronic acid and N-acetylglucosamine residues that are linked by beta-1-3 and beta-1-4 glycosidic bonds. It serves a variety of functions, including space filling, lubrication of joints, and provision of a matrix through which cells can migrate. HA is actively produced during wound healing and tissue repair to provide a framework for ingrowth of blood vessels and fibroblasts. AS1 is a member of the newly identified vertebrate gene family encoding putative hyaluronan synthases, and its amino acid sequence shows significant homology to the hasA gene product of Streptococcus pyogenes, a glycosaminoglycan synthetase (DG42) from Xenopus laevis, and a recently described murine hyaluronan synthase.
Immunogen: Amino acids NRAEDLYMVDMFREVFADEDPATYVWDGNYHQPWEPA were used as the immunogen for the HAS1 antibody.
Storage: After reconstitution, the HAS1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.
