GSTM1 Antibody | RQ4483

GSTM1 Antibody | RQ4483 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Purified

Clone: 11F2

Host Animal: Mouse

Clonality: Monoclonal (mouse origin)

Species Reactivity: Human, Mouse, Rat

Application: FACS, IHC-P, WB

Buffer: Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Limitation: This GSTM1 antibody is available for research use only.

Purity: Protein G affinity

Description: Glutathione S-transferase Mu 1 (gene name GSTM1) is a human glutathione S-transferase. Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. Null mutations of this class mu gene have been linked with an increase in a number of cancers, likely due to an increased susceptibility to environmental toxins and carcinogens. Multiple protein isoforms are encoded by transcript variants of this gene.

Immunogen: Amino acids EEEKIRVDILENQTMDNHMQLGMICYNPEFEKLK were used as the immunogen for the GSTM1 antibody.

Storage: After reconstitution, the GSTM1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.