Description
GSK3 alpha Antibody / GSK3A | RQ4122 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Antigen affinity purified
Clone: N/A
Host Animal: Rabbit
Clonality: Polyclonal (rabbit origin)
Species Reactivity: Mouse, Rat
Application: WB
Buffer: Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Limitation: This GSK3 alpha antibody is available for research use only.
Purity: Antigen affinity purified
Description: Glycogen synthase kinase-3 alpha is an enzyme that in humans is encoded by the GSK3A gene. This gene encodes a multifunctional Ser/Thr protein kinase that is implicated in the control of several regulatory proteins including glycogen synthase, and transcription factors, such as JUN. It also plays a role in the WNT and PI3K signaling pathways, as well as regulates the production of beta-amyloid peptides associated with Alzheimer's disease.
Immunogen: Amino acids QEVAYTDIKVIGNGSFGVVYQARLAETRELVAIKKVLQDKR from the human protein were used as the immunogen for the GSK3 alpha antibody.
Storage: After reconstitution, the GSK3 alpha antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.