GRP75 Antibody / HSPA9 | RQ6731

GRP75 Antibody / HSPA9 | RQ6731 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human, Mouse, Rat

Application: WB, IHC-P, IF, FACS

Buffer: Lyophilized from 1X PBS with 2% Trehalose

Limitation: This HSPA9 antibody is available for research use only.

Purity: Affinity purified

Description: HSPA9 (heat shock 70kDa protein 9 (mortalin)), also known as GRP75, mot-2, mthsp75, PBP74, HSPA9B, MORTALIN or MORTALIN, PERINUCLEAR, is a highly conserved member of the HSP70 family of proteins. It functions as a chaperone in the mitochondria, cytoplasm, and centrosome. The HSPA9 gene is mapped to chromosome 5q31.2 based on an alignment of the HSPA9 sequence with the genomic sequence. Knockdown of HSPA9 in erythroid cultures was associated with an increased number of cells in the G0/G1 phase of the cell cycle and accelerated apoptosis. Knockdown of Hspa9 in mouse bone marrow cells, followed by transplantation into wildtype recipients, also resulted in loss of erythroid cell number. Haploinsufficiency for HSPA9 may contribute to abnormal hematopoiesis in myelodysplastic syndromes. This protein plays a role in the control of cell proliferation.

Immunogen: C-terminal region amino acids KLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ from the human protein were used as the immunogen for the HSPA9 antibody.

Storage: After reconstitution, the HSPA9 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.