Description
GAL4 Antibody / Galectin-4 | R32387 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Antigen affinity purified
Clone: N/A
Host Animal: Rabbit
Clonality: Polyclonal (rabbit origin)
Species Reactivity: Human
Application: WB, IF/ICC, FACS
Buffer: N/A
Limitation: This GAL4 antibody is available for research use only.
Purity: Antigen affinity
Description: Galectin-4 is a protein that in humans is encoded by the LGALS4 gene. This gene is mapped to chromosome 19q13.2 based on an alignment of the LGALS4 sequence. The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS4 is an S-type lectin that is strongly underexpressed in colorectal cancer. The 323-amino acid LGALS4 protein contains 2 homologous, approximately 150-amino acid carbohydrate recognition domains and all amino acids typically conserved in galectins.
Immunogen: Amino acids DRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSY were used as the immunogen for the GAL4 antibody.
Storage: After reconstitution, the GAL4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.
