Description
FXR Antibody / Farnesoid X Receptor / Bile Acid Receptor NR1H4 (C-Terminal Region) | R32869 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Antigen affinity purified
Clone: N/A
Host Animal: Rabbit
Clonality: Polyclonal (rabbit origin)
Species Reactivity: Human
Application: WB, IF/ICC, FACS
Buffer: Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
Limitation: This NR1H4 antibody is available for research use only.
Purity: Antigen affinity
Description: The bile acid receptor (BAR), also known as farnesoid X receptor (FXR) or NR1H4 (nuclear receptor subfamily 1, group H, member 4) is a nuclear receptor that is encoded by the NR1H4 gene in humans. This gene encodes a ligand-activated transcription factor that shares structural features in common with nuclear hormone receptor family members. This protein functions as a receptor for bile acids, and when bound to bile acids, binds to DNA and regulates the expression of genes involved in bile acid synthesis and transport.
Immunogen: Amino acids 442-486 (QHFACLLGRLTELRTFNHHHAEMLMSWRVNDHKFTPLLCEIWDVQ) were used as the immunogen for the NR1H4 antibody.
Storage: After reconstitution, the NR1H4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.
