Fibrinogen beta chain Antibody (FGB) | RQ6233

(No reviews yet) Write a Review
SKU:
800-RQ6233
Weight:
1.20 KGS
€986.00
Frequently bought together:

Description

Fibrinogen beta chain Antibody (FGB) | RQ6233 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: 6D12

Host Animal: Mouse

Clonality: Monoclonal (mouse origin)

Species Reactivity: Human

Application: WB, IHC-P

Buffer: N/A

Limitation: This FGB antibody is available for research use only.

Purity: Affinity purified

Description: Fibrinogen beta chain, mapped to 4q31.3, is also known as FGB. The protein encoded by this gene is the beta component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in this gene lead to several disorders, including afibrinogenemia, dysfibrinogenemia, hypodysfibrinogenemia and thrombotic tendency. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Immunogen: Amino acids TNLRVLRSILENLRSKIQKLESDVSAQMEYCRT from the human protein were used as the immunogen for the FGB antibody.

Storage: After reconstitution, the FGB antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

View AllClose

Additional Information

Size:
100 ug
View AllClose