Description
Fetuin-A Antibody / AHSG | R31869 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Antigen affinity purified
Clone: N/A
Host Animal: Rabbit
Clonality: Polyclonal (rabbit origin)
Species Reactivity: Human, Rat
Application: WB, IHC-P, FACS, ELISA
Buffer: N/A
Limitation: This AHSG antibody is available for research use only.
Purity: Antigen affinity
Description: Alpha-2-HS-glycoprotein (AHSG), also known as Fetuin-A, is a protein that in humans is encoded by the AHSG gene. Fetuin-A belongs to the fetuin class of plasma binding proteins and is more abundant in fetal than adult blood. Its gene is mapped to 3q27. The protein is commonly present in the cortical plate of the immature cerebral cortex and bone marrow hemopoietic matrix. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue.
Immunogen: Amino acids DDPETEEAALVAIDYINQNLPWGYKHTLNQIDE of human AHSG were used as the immunogen for the AHSG antibody.
Storage: After reconstitution, the AHSG antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.
