Description
Fascin Antibody | R32251 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Antigen affinity purified
Clone: N/A
Host Animal: Rabbit
Clonality: Polyclonal (rabbit origin)
Species Reactivity: Human, Rat
Application: WB
Buffer: N/A
Limitation: This Fascin antibody is available for research use only.
Purity: Antigen affinity
Description: Organizes filamentous actin into bundles with a minimum of 4.1:1 actin/fascin ratio. Plays a role in the organization of actin filament bundles and the formation of microspikes, membrane ruffles, and stress fibers. Important for the formation of a diverse set of cell protrusions, such as filopodia, and for cell motility and migration. [UniProt]
Abnormal fascin expression or function has been implicated in breast cancer, colon cancer, esophageal squamous cell carcinoma, gallbladder cancer and prostate cancer.
Immunogen: Amino acids KKQIWTLEQPPDEAGSAAVCLRSHLGRYLAAD of human Fascin were used as the immunogen for the Fascin antibody.
Storage: After reconstitution, the Fascin antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.
