Factor V Antibody | RQ4396

(No reviews yet) Write a Review
SKU:
800-RQ4396
Weight:
1.20 KGS
€986.00
Frequently bought together:

Description

Factor V Antibody | RQ4396 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human

Application: WB

Buffer: Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Limitation: This Factor V antibody is available for research use only.

Purity: Antigen affinity purified

Description: Factor V is a protein of the coagulation system, rarely referred to as proaccelerin or labile factor. The gene for factor V is located on the first chromosome (1q23). This gene encodes an essential cofactor of the blood coagulation cascade. This factor circulates in plasma, and is converted to the active form by the release of the activation peptide by thrombin during coagulation. This generates a heavy chain and a light chain which are held together by calcium ions. The activated protein is a cofactor that participates with activated coagulation factor X to activate prothrombin to thrombin. Defects in this gene result in either an autosomal recessive hemorrhagic diathesis or an autosomal dominant form of thrombophilia, which is known as activated protein C resistance.

Immunogen: Amino acids ESTVMATRKMHDRLEPEDEESDADYDYQNRLAAALGIR from the human protein were used as the immunogen for the Factor V antibody.

Storage: After reconstitution, the Factor V antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

View AllClose

Additional Information

Size:
100 ug
View AllClose