Description
Exportin-5 Antibody (N-Terminal Region) | R32934 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Antigen affinity purified
Clone: N/A
Host Animal: Rabbit
Clonality: Polyclonal (rabbit origin)
Species Reactivity: Human, Mouse, Rat
Application: WB
Buffer: Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
Limitation: This Exportin-5 antibody is available for research use only.
Purity: Antigen affinity
Description: Exportin-5 (XPO5) is a protein that in humans is encoded by the XPO5 gene. The International Radiation Hybrid Mapping Consortium mapped the XPO5 gene to chromosome 6. This gene encodes a member of the karyopherin family that is required for the transport of small RNAs and double-stranded RNA-binding proteins from the nucleus to the cytoplasm. The encoded protein translocates cargo through the nuclear pore complex in a RanGTP-dependent process.
Immunogen: Amino acids 2-43 (AMDQVNALCEQLVKAVTVMMDPNSTQRYRLEALKFCEEFKEK) were used as the immunogen for the Exportin-5 antibody.
Storage: After reconstitution, the Exportin-5 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.
