ETV4 Antibody / PEA3 | R32103

(No reviews yet) Write a Review
SKU:
800-R32103
Weight:
1.20 KGS
€986.00
Frequently bought together:

Description

ETV4 Antibody / PEA3 | R32103 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human, Rat

Application: WB

Buffer: N/A

Limitation: This ETV4 antibody is available for research use only.

Purity: Antigen affinity

Description: ETS translocation variant 4 (ETV4), also known as polyoma enhancer activator 3 (PEA3), or E1AF, is a member of the PEA3 subfamily of Ets transcription factors. It is mapped to 17q21.31. E1AF can activate the promoters of various matrix metalloproteinases, genes whose expression is associated with tumor cell invasion and metastasis, by 10 to 20 fold. Pea3 is detected in cells of epithelial and fibroblastic origin. It is also a transcriptional activator that binds to the enhancer of the adenovirus E1A gene.

Immunogen: Amino acids MERRMKAGYLDQQVPYTFSSKSPGNGSLREALIGPLGKLMD of human PEA3/ETV4 were used as the immunogen for the ETV4 antibody.

Storage: After reconstitution, the ETV4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

View AllClose

Additional Information

Size:
100 ug
View AllClose