ERV3 Antibody / ERV3-1 | R32228

(No reviews yet) Write a Review
SKU:
800-R32228
Weight:
1.20 KGS
€986.00
Frequently bought together:

Description

ERV3 Antibody / ERV3-1 | R32228 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human

Application: WB

Buffer: N/A

Limitation: This ERV3 antibody is available for research use only.

Purity: Antigen affinity

Description: HERV-R_7q21.2 provirus ancestral Env polyprotein, also known as ERV3-1, is a protein that in humans is encoded by the ERV3 gene. By radiation hybrid analysis, the ERV3 gene is mapped to chromosome 7q11.2. The human genome includes many retroelements including the human endogenous retroviruses (HERVs). ERV3, one of the most studied HERVs, is thought to have integrated 30 to 40 million years ago and is present in higher primates with the exception of gorillas. Taken together, the observation of genome conservation, the detection of transcript expression, and the presence of conserved ORFs is circumstantial evidence for a functional role. A functional role is also suggested by the observation that downregulation of ERV3 is reported in choriocarcinoma.

Immunogen: Amino acids LELDDEGKVIKEITAKIQKLAHIPVQTWKG of human ERV3 were used as the immunogen for the ERV3 antibody.

Storage: After reconstitution, the ERV3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

View AllClose

Additional Information

Size:
100 ug
View AllClose