ELF1 Antibody / E74 like factor 1 | RQ4212

ELF1 Antibody / E74 like factor 1 | RQ4212 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human

Application: WB

Buffer: Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Limitation: This Elf-1 antibody is available for research use only.

Purity: Antigen affinity purified

Description: E74-like factor 1 (ets domain transcription factor) is a protein that in humans is encoded by the ELF1 gene. It is mapped to chromosome 13q13. This gene encodes an E26 transformation-specific related transcription factor. The encoded protein is primarily expressed in lymphoid cells and acts as both an enhancer and a repressor to regulate transcription of various genes. Alternative splicing results in multiple transcript variants.

Immunogen: Amino acids QPTQSPYPTQLFRTVHVVQPVQAVPEGEAARTSTMQDE were used as the immunogen for the Elf-1 antibody.

Storage: After reconstitution, the Elf-1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.