Description
ELAVL2 Antibody / ELAV-like protein 2 | RQ4564 | Gentaur US, UK & Europe Disrtribition
Family: Primary antibody
Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format: Purified
Clone: N/A
Host Animal: Rabbit
Clonality: Polyclonal (rabbit origin)
Species Reactivity: Human, Mouse
Application: WB, IHC-P
Buffer: N/A
Limitation: N/A
Purity: Antigen affinity purified
Description: ELAV-like protein 2 is a protein that in humans is encoded by the ELAVL2 gene. This gene encodes a member of the cytochrome P450 superfamily of enzymes, and is commonly known as sterol 27-hydroxylase. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This mitochondrial protein oxidizes cholesterol intermediates as part of the bile synthesis pathway. Since the conversion of cholesterol to bile acids is the major route for removing cholesterol from the body, this protein is important for overall cholesterol homeostasis. Mutations in this gene cause cerebrotendinous xanthomatosis, a rare autosomal recessive lipid storage disease.
Immunogen: Amino acids METQLSNGPTCNNTANGPTTINNNCSSPVDSGNTEDSK were used as the immunogen for the ELAVL2 antibody.
Storage: After reconstitution, the ELAVL2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.
