EEF2 Antibody / Elongation factor 2 | RQ6234

(No reviews yet) Write a Review
SKU:
800-RQ6234
Weight:
1.20 KGS
€986.00
Frequently bought together:

Description

EEF2 Antibody / Elongation factor 2 | RQ6234 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: 5F5

Host Animal: Mouse

Clonality: Monoclonal (mouse origin)

Species Reactivity: Human, Mouse, Rat

Application: WB, IHC-P, IF, FACS

Buffer: N/A

Limitation: This EEF2 antibody is available for research use only.

Purity: Affinity purified

Description: Eukaryotic elongation factor 2 is a protein that in humans is encoded by the EEF2 gene. This gene encodes a member of the GTP-binding translation elongation factor family. This protein is an essential factor for protein synthesis. It promotes the GTP-dependent translocation of the nascent protein chain from the A-site to the P-site of the ribosome. This protein is completely inactivated by EF-2 kinase phosporylation.

Immunogen: Amino acids QTETVLRQAIAERIKPVLMMNKMDRALLELQLEPEELYQTFQR from the human protein were used as the immunogen for the EEF2 antibody.

Storage: After reconstitution, the EEF2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

View AllClose

Additional Information

Size:
100 ug
View AllClose