DNA Polymerase iota Antibody / POLI | RQ4298

DNA Polymerase iota Antibody / POLI | RQ4298 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human, Mouse, Rat

Application: WB

Buffer: Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Limitation: This DNA Polymerase iota antibody is available for research use only.

Purity: Antigen affinity purified

Description: DNA polymerase iota is an enzyme that in humans is encoded by the POLI gene. The protein encoded by this gene is an error-prone DNA polymerase involved in DNA repair. The encoded protein promotes DNA synthesis across lesions in the template DNA, which other polymerases cannot do. The encoded polymerase inserts deoxynucleotides across lesions and then relies on DNA polymerase zeta to extend the nascent DNA strand to bypass the lesion.

Immunogen: Amino acids DIDPQVFYELPEAVQKELLAEWKRAGSDFHIGHK were used as the immunogen for the DNA Polymerase iota antibody.

Storage: After reconstitution, the DNA Polymerase iota antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.