Dishevelled 3 Antibody / DVL3 | R32781

Dishevelled 3 Antibody / DVL3 | R32781 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Mouse, Rat

Application: WB

Buffer: Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide

Limitation: This DVL3 antibody is available for research use only.

Purity: Antigen affinity

Description: Segment polarity protein dishevelled homolog DVL-3 is a protein that in humans is encoded by the DVL3 gene. It is mapped to 3q27.1. This gene is a member of a multi-gene family which shares strong similarity with the Drosophila dishevelled gene, dsh. The Drosophila dishevelled gene encodes a cytoplasmic phosphoprotein that regulates cell proliferation.

Immunogen: Amino acids 397-434 (DTERLDDFHLSIHSDMAAIVKAMASPESGLEVRDRMWL) from the human protein were used as the immunogen for the DVL3 antibody.

Storage: After reconstitution, the DVL3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.