Dishevelled 2 Antibody / DVL2 | R32637

(No reviews yet) Write a Review
SKU:
800-R32637
Weight:
1.20 KGS
€986.00
Frequently bought together:

Description

Dishevelled 2 Antibody / DVL2 | R32637 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human, Mouse, Rat

Application: WB

Buffer: Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide

Limitation: This Dishevelled 2 antibody is available for research use only.

Purity: Antigen affinity

Description: Segment polarity protein dishevelled homolog DVL-2 is a protein that in humans is encoded by the DVL2 gene. This gene encodes a member of the dishevelled (dsh) protein family. The vertebrate dsh proteins have approximately 40% amino acid sequence similarity with Drosophila dsh. This gene encodes a 90-kD protein that undergoes posttranslational phosphorylation to form a 95-kD cytoplasmic protein, which may play a role in the signal transduction pathway mediated by multiple Wnt proteins. The mechanisms of dishevelled function in Wnt signaling are likely to be conserved among metazoans.

Immunogen: Amino acids 35-64 (AERITLGDFKSVLQRPAGAKYFFKSMDQDF) from the human protein were used as the immunogen for the Dishevelled 2 antibody.

Storage: After reconstitution, the Dishevelled 2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

View AllClose

Additional Information

Size:
100 ug
View AllClose