DHODH Antibody | RQ6591

DHODH Antibody | RQ6591 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human, Mouse, Rat

Application: WB, IF, FACS

Buffer: Lyophilized from 1X PBS with 2% Trehalose

Limitation: This DHODH antibody is available for research use only.

Purity: Antigen affinity purified

Description: Dihydroorotate dehydrogenase (DHODH) is an enzyme that in humans is encoded by the DHODH gene on chromosome 16. The protein encoded by this gene catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane.

Immunogen: N-terminal region amino acids RVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTED from the human protein were used as the immunogen for the DHODH antibody.

Storage: After reconstitution, the DHODH antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.