DHODH Antibody | R32524

DHODH Antibody | R32524 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human, Mouse, Rat

Application: WB, IHC-P

Buffer: Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Limitation: This DHODH antibody is available for research use only.

Purity: Antigen affinity

Description: Dihydroorotate dehydrogenase is an enzyme that in humans is encoded by the DHODH gene on chromosome 16. The protein encoded by this gene catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane.

Immunogen: Amino acids 132-173 (RVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTED) from the human protein were used as the immunogen for the DHODH antibody.

Storage: After reconstitution, the DHODH antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.