DDAH1 Antibody | R32437

DDAH1 Antibody | R32437 | Gentaur US, UK & Europe Disrtribition

Family: Primary antibody

Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water

Format: Antigen affinity purified

Clone: N/A

Host Animal: Rabbit

Clonality: Polyclonal (rabbit origin)

Species Reactivity: Human, Mouse, Rat

Application: WB, IHC-P, FACS, IF

Buffer: Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Limitation: This DDAH1 antibody is available for research use only.

Purity: Antigen affinity

Description: DDAH1 is knowns as dimethylarginine dimethylaminohydrolase 1 which is mapped to chromosome 1p22 by radiation hybrid and FISH analysis. This gene belongs to the dimethylarginine dimethylaminohydrolase (DDAH) gene family. DDAH1 plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity. It widely expressed, especially in liver and kidney.

Immunogen: Amino acids QKALKIMQQMSDHRYDKLTVPDDIAANCIYLN were used as the immunogen for the DDAH1 antibody.

Storage: Prior to reconstitution, store at 4oC. After reconstitution, the DDAH1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 °C. Avoid repeated freezing and thawing.